PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00362g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HSF
Protein Properties Length: 254aa    MW: 28895.5 Da    PI: 5.529
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00362g00007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind781.5e-242894268
                              HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---S CS
              HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkde 68
                              Fl k+y ++ed+++++++sw+++g +fvv+++ efa+++Lp++Fkhsnf+SFvRQLn+Y+    ++ 
  Niben101Scf00362g00007.1 28 FLLKTYMLVEDPATDDVVSWNSDGAAFVVWQPAEFARDLLPTFFKHSNFSSFVRQLNTYQQAGGSSA 94
                              9**********************************************************86554444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.3E-262187IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467856.67E-222387IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.2E-2324192IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004477.4E-212890IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-132851IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-136678IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-137991IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MMVVVEEVQR DEKSLLLEYV RKSSPSPFLL KTYMLVEDPA TDDVVSWNSD GAAFVVWQPA  60
EFARDLLPTF FKHSNFSSFV RQLNTYQQAG GSSAMTSLER EKGNYYVIFV VEKHGQTDTN  120
QTTTITTINK NNNNNGQSQC ANSNKKETEE DQRSSSSTSS SSSELTILAD ENKRLKMENG  180
VLSSELSVMK NKCKKLTDIV TIFAKNPEKE EKKQQDERPM LFGVRLEVQE EMERKRKRAE  240
LTETASVFLS QLCK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5w_B3e-152686262Putative transcription factor
5d5x_B3e-152686262Putative transcription factor
5d5x_E3e-152686262Putative transcription factor
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796891.11e-129PREDICTED: heat stress transcription factor B-3-like
RefseqXP_016514635.11e-129PREDICTED: heat stress transcription factor B-3-like
TrEMBLM1CLT12e-93M1CLT1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000701965e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44232241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41690.12e-39heat shock transcription factor B3